SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019082 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000019082
Domain Number - Region: 38-156
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0942
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019082   Gene: ENSOGAG00000031227   Transcript: ENSOGAT00000025159
Sequence length 169
Comment pep:novel scaffold:OtoGar3:GL873552.1:15474650:15475156:1 gene:ENSOGAG00000031227 transcript:ENSOGAT00000025159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKAKPKGKEAKPQPKDSVGTRTGCSRYQWEVQDSNKQFWTKGYAEVKLLSLLCLCGTT
IMFYSIPVHPLLRVVVMMETTVFCFFFLLYSLAIQRYTTYILWPVADLLNDLITFSFLLG
AVIYGVKIRASLPGLYLGGLILMVFAGIFALADVYLQRNYFKGTTTKKD
Download sequence
Identical sequences H0XSJ0
ENSOGAP00000019082 ENSOGAP00000019082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]