SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019094 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019094
Domain Number 1 Region: 8-289
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-87
Family PAPS sulfotransferase 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019094   Gene: ENSOGAG00000025916   Transcript: ENSOGAT00000026609
Sequence length 294
Comment pep:novel scaffold:OtoGar3:GL873521.1:12629556:12645661:1 gene:ENSOGAG00000025916 transcript:ENSOGAT00000026609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLETNLLKFKGYYFRNERFNINLLENTDDFEVRDDDVFLVTYPKSGTIWCQQILSLIY
FEEHRKRTEHLETADRVPYFEYMFEKLDFDESPSPRLFTTHLPYYLVPRGLKNKKAKIIY
VYRNPKDVMCSYFYFVNMLPIFKAADTIEEFMKQFLEGKVMGSLWFDHIRGWYEHRSHFN
IQFMAYEEMKKDLRSSVLKLCKFLGKDLSGEAVDDVVRQATFESMKDDPLANYENVLNTR
VGVTRREGHFLRKGTIGDWKNHMTVEQNERFDKIFQEQMKDFPLQFLWDINEIS
Download sequence
Identical sequences H0XSK2
ENSOGAP00000019094 ENSOGAP00000019094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]