SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019097 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019097
Domain Number 1 Region: 215-453
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-51
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 52-164
Classification Level Classification E-value
Superfamily POZ domain 1.6e-29
Family Tetramerization domain of potassium channels 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019097   Gene: ENSOGAG00000029674   Transcript: ENSOGAT00000027801
Sequence length 512
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:28042901:28045042:-1 gene:ENSOGAG00000029674 transcript:ENSOGAT00000027801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSPAGRGSFPPASAAGAGAPRCSAPARCGRPGAFSMTGQSLWDVSEANVEDGEIRINVGG
FKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFY
HTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTT
SSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSILSILVVLGSIITMC
LNSLPDFQIHDSQGNPGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDL
MSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYS
YKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTT
AGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGLKEVPSVNLR
DYYAHKVKSLMASLTNMSRSSPSELSLNDSLH
Download sequence
Identical sequences H0XSK5
ENSOGAP00000019097 ENSOGAP00000019097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]