SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019116 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019116
Domain Number 1 Region: 396-587
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.54e-49
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 149-394
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.11e-38
Family Voltage-gated potassium channels 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019116   Gene: ENSOGAG00000026326   Transcript: ENSOGAT00000024436
Sequence length 681
Comment pep:known_by_projection scaffold:OtoGar3:GL873602.1:4455560:4472272:-1 gene:ENSOGAG00000026326 transcript:ENSOGAT00000024436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKNIINTQHSFVNKTNVIVPDIEKEIRRMENGACSSFSEDDASACASDESENDARGSFR
HNSRRKGEPSQREQHLPGAIALFNVNNSSNKEQEPKEKKKKKKEKKSKSDDKKDPEKKKK
KEQEKEKKKKEEKSNEKKEEKKKEVMVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFE
ELQSDYLEYWIVCDYVSDVVYLLDMFVRTRTGYLEQGLLVKEERKLIDKYKENLQFKLDV
LSVIPTDLMYFKLGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVII
IHWNACVYYSISKAIGFGNDTWVYPDVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPV
LDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMNFRNVSKDM
EKRVIKWFDYLWTNKKTVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVE
LVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISIL
NIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGKQILMKDGLLD
INIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQGKLKQRLTKVERFLKPLI
DTEFSAIEGPEEESGPVDSTT
Download sequence
Identical sequences H0XSM4
ENSOGAP00000019116 ENSOGAP00000019116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]