SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019150 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019150
Domain Number 1 Region: 160-400
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-55
Family Voltage-gated potassium channels 0.00081
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily POZ domain 6.28e-25
Family Tetramerization domain of potassium channels 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019150   Gene: ENSOGAG00000030433   Transcript: ENSOGAT00000034359
Sequence length 447
Comment pep:known_by_projection scaffold:OtoGar3:GL873525.1:24040286:24050595:-1 gene:ENSOGAG00000030433 transcript:ENSOGAT00000034359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVGGHSYRLDYCELVGYPKTRLGRLATSTSRSRQLSLCDDYEAETDEYFFDRDPAVFQL
VYNFYVSGVLLVLDGLCPRCFLEELGYWGVRLKYTPRCCRICFEERRDELSEQLKIQREL
RAQAQAEEAEELFRDMRFYGPQRRRLWNLMEKPFSSVAAKAIGVASSLFVLISVVALALN
TVEEAQHHAEEGADSPDLRPILEHVEMLCIGFFTLEYLLRLASTPDLRRFTRSALNLVDL
VAILPLYLQLLLESITGEDQQHGQTAGRVGSVGKVGQVLRIMRLMRIFRILKLARHSTGL
RAFGFTLRQCYQQVGCLMLFITMGIFAFSAAVYSVEHDVPGTNFTSIPHAWWWAAVSIST
VGYGDVYPETHLGRLFAFLCIAFGIILNGMPISILYNKFSDYYSKLKAYEYTAIRRERGK
VNFMQRARKKMAECLAGSNSQPTPQQE
Download sequence
Identical sequences H0XSQ8
ENSOGAP00000019150 ENSOGAP00000019150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]