SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019162 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019162
Domain Number 1 Region: 81-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019162   Gene: ENSOGAG00000029573   Transcript: ENSOGAT00000035029
Sequence length 224
Comment pep:known_by_projection scaffold:OtoGar3:GL873574.1:6094381:6097311:1 gene:ENSOGAG00000029573 transcript:ENSOGAT00000035029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELSLSPEARGSLEDKGLGTPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPGECSSHSASCSPEWGSALEFG
TNPGDHLLASDPTDAHNLHSLTSIVDSITVEDVAVAFPDETMPN
Download sequence
Identical sequences H0XSS0
ENSOGAP00000019162 XP_003792308.2.62490 ENSOGAP00000019162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]