SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019166 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019166
Domain Number 1 Region: 19-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 227-341
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000327
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 430-467
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 140-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000825
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 186-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 391-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000019166
Domain Number - Region: 363-390
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00314
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019166   Gene: ENSOGAG00000034429   Transcript: ENSOGAT00000034073
Sequence length 746
Comment pep:known_by_projection scaffold:OtoGar3:GL873654.1:4554555:4564789:1 gene:ENSOGAG00000034429 transcript:ENSOGAT00000034073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMI
TISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDAS
SSGQAQGFRLSYIRGKLGQATCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPA
SEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGS
FASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQT
LSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSGEGDGA
DSGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCP
DGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIG
SLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPP
VEDFPVYSASQASVLQSLRTAMRRQMRRHTSRRGPSRRRLGRLWNRLFHRPRAPRGQIPL
LTAGRTSQTVLGDGLLQPAPGAAPDPSAPLTDTGSPRAAGDGPSSAPNHVVEVGPLAPPP
PSGPQDPECRPVDKDTKAGRDTLVDRPTPVDTSWEPCSAQDPHTQSPTASSTRGPHSPEP
LGVCRSPPPPCSPMLEASDDEALLVC
Download sequence
Identical sequences H0XSS4
ENSOGAP00000019166 ENSOGAP00000019166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]