SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019284 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019284
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.4e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019284   Gene: ENSOGAG00000034073   Transcript: ENSOGAT00000027441
Sequence length 179
Comment pep:known_by_projection scaffold:OtoGar3:GL873561.1:13534276:13536605:-1 gene:ENSOGAG00000034073 transcript:ENSOGAT00000027441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSLSDVEDLQEVEMLECDGLKIDSNKEFVTSNESTEEGSTCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Download sequence
Identical sequences H0XT42
ENSOGAP00000019284 ENSOGAP00000019284 XP_003790363.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]