SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019290 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019290
Domain Number 1 Region: 507-942
Classification Level Classification E-value
Superfamily RNI-like 1.7e-75
Family 28-residue LRR 0.0000266
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-19
Family Pyrin domain, PYD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019290   Gene: ENSOGAG00000031696   Transcript: ENSOGAT00000025002
Sequence length 1004
Comment pep:novel scaffold:OtoGar3:GL873783.1:64273:83094:-1 gene:ENSOGAG00000031696 transcript:ENSOGAT00000025002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESFSAAFDLLWYLEKLSDEEFHSFKSHLEQEIQQFGLPQIPLTDLEVSKEVLVNTLRS
SYEEQHTWNMTFSILQKLGHKDLCEKITIRQNRNKEMHKCLMRTKFLSQWETCRFSEIHY
SFFSEVTCDIFYILESSYDSSTSSKENLNVFLVGDRATGKSMITKMAVTKWTVGEMWKAP
IADILSDPRKVLFILEDLDNMNVDLNVDESALCSDSRRKVPVSVLLVSLLKRKMVPGCWV
LVSSRPSCEPSIKALMNERDCYVTLQLSNEKKQHYFHLFFNNQERAVLTFKFVLMSEILV
DLCEVPLLSWILCTVLNQQINQGEDIGFSCETPTDIYTHYLASVLASDPEVTARQHHLIL
LNRLCLLALEGLSHNTLRFSRNDLVSVGFTSDDVSVLQAMNILLRSSNHQVRFEFIHLNI
QEFCAALASLMVLPRRWIPSARRRKKEKRELYDNFSPVVTSIFGLLNEKRRKILETSLGC
QLPMVESLRQNLLMQMKYLGNNPNLMEHHMPLFYCFLENLEEEFVKEIMSFFSEATIFIQ
DNKDLMVSLYCLQHCQPLQKLKLSVQQVFRCETPISMLTSSQIRGLTFWMHICSLFYTKE
NFRELEICTSDFNRISELLLCKALRHPNCQLQTLRLSYVSVSSNFNDLFMSMACNQNLTF
LNVNCIPISPKMFSLLCEALSSPTCNIQHLSLMRCDLQASACPEIASILISSKKLKKLTL
SNNPLKNDGVKILCDALFHPECVLESLGLYFCCLTERCVAYIARVLMFSTTLKHLDLSVN
CLQNRAVLALTFPLSLPECHLQELELTGCFFNNEVCHYIASSLISNVHLRRLELGYNNLG
DAGVESLCNALQHQDCKLETVGLEGCMLTSACCTTLASVFSSSKTLKKLNLIENNLGDEG
IMKLIQGLGHPSCVLELLGIGVSDLSAETQSLLMAVREKNTKLEFSSSFSTVKEGRQFND
LLGSGNPPEPASTTPNYPWHSIFFKLPRKFSSMTEETTVSEQSL
Download sequence
Identical sequences H0XT48
ENSOGAP00000019290 ENSOGAP00000019290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]