SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019349 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019349
Domain Number 1 Region: 8-160
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.97e-41
Family Rap30/74 interaction domains 0.000000413
Further Details:      
 
Domain Number 2 Region: 357-411
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000196
Family C-terminal domain of the rap74 subunit of TFIIF 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019349   Gene: ENSOGAG00000026618   Transcript: ENSOGAT00000024704
Sequence length 415
Comment pep:novel scaffold:OtoGar3:GL873552.1:3381001:3382377:-1 gene:ENSOGAG00000026618 transcript:ENSOGAT00000024704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPGPVNQAVTECTVRVPKNSNKKYSIMAFNAADKVNFATWSQARLERDLSDMKNYQEV
EMTRSGAGTKFSRKLGDEAAGKKDGIGLQGFRAEDQPWLLQVSGESGRKFKGIKRGGVTE
NASYYIFTQCPDGSFEAFPVYEWYNFTPLARHHTPIAEEGGKAGRSNKVQNHLSIMQQRR
PRDQHQDQGEEDKKARELHILNLEGDLQMSSQDSVASGERGSRAPQAKKKVPPSLVGGKR
KKKGSDDKTFQDGANGNKHRKDSSKESEGSEESGIDSETSWAFFMEKREQKPSRGSSRAR
NCPGTPSTTSALGAAPNWLEQGKCAGKTPAAKRLRLDTGPQSLPGRSAPQPPSGKSTPSS
GEVQVTEDAVRHYLTQKPMTTKDLLKKMGLSSEQTVNMQAQNLTWFNPELKILKE
Download sequence
Identical sequences H0XTA7
ENSOGAP00000019349 ENSOGAP00000019349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]