SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019353 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019353
Domain Number 1 Region: 17-115
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000195
Family Snake venom toxins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019353   Gene: ENSOGAG00000030235   Transcript: ENSOGAT00000032797
Sequence length 143
Comment pep:novel scaffold:OtoGar3:GL873764.1:1774903:1775794:-1 gene:ENSOGAG00000030235 transcript:ENSOGAT00000032797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFQGAMGGIHLFLLVILLCSKQALSLKCYACPENDDSRCLVTTCPPGPAYCFIANMTVID
SDGKKSSAMPKGCIVSCETSSQAANSKPGSFVEGKKPSTFEVKDLKCCDQDLCNGAVQVR
HGLWTLAGALLLSLGPMLLWTLL
Download sequence
Identical sequences H0XTB1
ENSOGAP00000019353 ENSOGAP00000019353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]