SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019381 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019381
Domain Number 1 Region: 146-341
Classification Level Classification E-value
Superfamily E set domains 1.45e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 37-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-23
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019381   Gene: ENSOGAG00000026356   Transcript: ENSOGAT00000033343
Sequence length 393
Comment pep:known_by_projection scaffold:OtoGar3:GL873610.1:822715:826966:-1 gene:ENSOGAG00000026356 transcript:ENSOGAT00000033343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQENAAFSPGPEEPPRRRGRQRYVEKDGRCNVQHGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Download sequence
Identical sequences H0XTD9
ENSOGAP00000019381 ENSOGAP00000019381 XP_003795247.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]