SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019391 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019391
Domain Number 1 Region: 392-546,578-643
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000102
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Domain Number 2 Region: 73-274
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000251
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019391   Gene: ENSOGAG00000030843   Transcript: ENSOGAT00000029636
Sequence length 761
Comment pep:novel scaffold:OtoGar3:GL873667.1:2689722:2719123:-1 gene:ENSOGAG00000030843 transcript:ENSOGAT00000029636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRSPSLSPDGDQDLLLAAAYVSDAQYNRNVPFETSPQAISFHSHKSLEYWCLVGIYVFVC
KGLQPGLCPNPQVSASPLQATSIVEVLCLTAFFGRLLHFAKVTPQMVFWKDTKNICIMVT
IVLTLVDLILYGSLETVNIRSVRWSRALRPVFLINFPESRQIRRAFRSLRNTLPDILYVF
LLFMFSMLVFSLMALKLFGDRGLKTAEGSPYFANILEIAFELYVLVTTANSPDVMMPAYD
FNWWYSLYFITYIIINTYIFMSVFLAVVYNNYRKHLKNEIRKLAYLKRHKMIEAFNILKV
KVDAEFMVQEAQWRRLVHAVAPDMSRGHLELLLRISDEGQTGHVDKMNFLRLADLLNIQV
VTVNIKRHPLEAWVPRVYQSSASLLVQRMVRHRIFVWVFDVIILINAIFIALDEKNPFIS
YAEWLFLSLYIIEILLKLYTYEPRAYFGRKQFWNWFDTLIIIAALVATVANTTIQSAKKY
NSQQILDIVLILRILRLLRVIVSIQRFRVIVTTLINIGPTMLTFGGLVFVVYYAFAIVGM
EVFHGKVQFFDPNFTTPDALVCGNPALKGSAFSQSRYCKNNFNDLASSFVVLMELTVVNQ
WHDILHGFALVTHPAAKLYFILFHIVVVILIVNIFIAFVLEAFFVAYSLEKSEVETAIEK
KIQELGVGLQEEEVQDGKKPSDHVDNKDCHFHKDVGDKKKKALEGLYCRIASKKYRTVDT
LLQRMFESEIAPEDEGPSLDEILNFSPSDMYPKNPNFENSA
Download sequence
Identical sequences H0XTE9
ENSOGAP00000019391 ENSOGAP00000019391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]