SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019423 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019423
Domain Number 1 Region: 118-180
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.71e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019423   Gene: ENSOGAG00000010543   Transcript: ENSOGAT00000010546
Sequence length 382
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:24365338:24366486:1 gene:ENSOGAG00000010543 transcript:ENSOGAT00000010546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRLFSEPGLLSDVPKFASWGDGDDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPL
RGEEVPEATLAEVKEESELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYP
YPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLS
YDMHLHHDRGPMYEELNAFFHN
Download sequence
Identical sequences A0A2K6EL75 H0XTI1
XP_003786470.1.62490 XP_012516530.1.63892 ENSOGAP00000019423 ENSOGAP00000019423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]