SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019426 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019426
Domain Number 1 Region: 277-508
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.16e-21
Family Phospholipase D 0.065
Further Details:      
 
Domain Number 2 Region: 131-270
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.77e-18
Family Nuclease 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019426   Gene: ENSOGAG00000032441   Transcript: ENSOGAT00000028285
Sequence length 525
Comment pep:known_by_projection scaffold:OtoGar3:GL873660.1:4762445:5116549:1 gene:ENSOGAG00000032441 transcript:ENSOGAT00000028285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIRQHEWLSASPHEGFEQMRLKSRPKEPSPSLTRVGANFYSSVKQQDYSASVWLRRKDK
LEHSQQKCIVIFALVCCFAILVALIFSAVDIMGEDEDGLSEKNCQNKCRIALVENIPEGL
NYSENAPFHLSLFQGWMNLLNMAKKSVDIVSSHWDLNHTHPSACQGQRLFEKLLQLTSQN
IEVKLVSDVTADSKVLEALKLKGAEVTYMNMTAYNKGRLQSSFWIVDKQHVYIGSAGLDW
QSLGQMKELGVIFYNCSCLVLDLQRIFALYSSLKFKSRVPQTWSKRLYGVYDNEKKLQLQ
LNETQSQAFVSNSPKLFCPKNRSFDIDAIYSVIDDAKQYVYIAVMDYLPISSTSTRRTYW
PDLDGKIREALVLRSVKVRLLISFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLER
ENACATKEQKNHTFPKLNRNKYMVTDGAAYIGNFDWVGNDFTHNAGTGLVINQADVRNNR
SIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLFKLNPPSNKTAT
Download sequence
Identical sequences H0XTI4
ENSOGAP00000019426 ENSOGAP00000019426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]