SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019435 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019435
Domain Number 1 Region: 159-356
Classification Level Classification E-value
Superfamily E set domains 5.6e-81
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000989
Further Details:      
 
Domain Number 2 Region: 38-86,115-175
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-23
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019435   Gene: ENSOGAG00000001534   Transcript: ENSOGAT00000001535
Sequence length 444
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:9562179:9563513:1 gene:ENSOGAG00000001534 transcript:ENSOGAT00000001535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPMVPTAGGPTGIGGPAPTAPKPCIMHVNGF
LGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKR
AQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRD
LNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTT
QARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVL
PAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGS
HLDLERMQATLPLDSISYRRESAI
Download sequence
Identical sequences H0XTJ3
ENSOGAP00000019435 ENSOGAP00000019435 XP_003783250.1.62490 XP_003783251.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]