SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019512 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019512
Domain Number 1 Region: 81-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019512   Gene: ENSOGAG00000025742   Transcript: ENSOGAT00000029119
Sequence length 374
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:360887:362814:-1 gene:ENSOGAG00000025742 transcript:ENSOGAT00000029119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSPTPQSLLSHDHWMFFQGWGWASHSDSTSPASSSDSSGSCPYDNNRGPLQPAPPARS
APAADAAPTAPRRARPWPAGGQRRSASEREKLRMRTLARALHELRRFLPPSVAPSGQSLT
KIETLRLAIRYIGHLSAVLGLSEESLQRRRRGHSDAASPRGCPLCPDGWPEQAQAQTQVQ
VQMRGSDLGSATCPGASWGSPPVCPGPGAVLAHPETGVPDPNHWVAPLYHPKMQSPSHPS
QGRNPDESVWMPPQAFPRAQTSPEPGNLAVPWTTPPGPLELAAVYQGISVSRESCLSPGS
PPLLPGQSCQRLQPQTQWGCWVQSTEVLPSEDQEPGPTFQLSDASPPQSSGLQLRDCPEL
WQEDLEGAHLGCFF
Download sequence
Identical sequences H0XTS0
XP_003788853.1.62490 ENSOGAP00000019512 ENSOGAP00000019512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]