SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019568 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019568
Domain Number 1 Region: 521-711
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-53
Family cAMP-binding domain 0.00000000951
Further Details:      
 
Domain Number 2 Region: 256-524
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-37
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019568   Gene: ENSOGAG00000027137   Transcript: ENSOGAT00000025824
Sequence length 1200
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:25387757:25433601:-1 gene:ENSOGAG00000027137 transcript:ENSOGAT00000025824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEDGAGGRQDPSRRSIRLRPLPSPSPSV
AAGSTETRGAALGAADSEGPARGAAKSSTNGDCRRFRGSLASLGSRGGGGGGAGSGSSHG
HLHDSAEERRLIAEGDASPAEDRTPPGLAVDSERPGASAQPAASPPPPQQPPQPASASCE
QPSADTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAV
EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV
VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVE
TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN
LIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIG
YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE
ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI
LLHKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA
PLQAAAATTSVAIALTHHPRLPATIFRPPPGPGLGNLGAGQTPRHLKRLQSLIPSALGST
SPASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGACGSPAAPTPSAATA
ATTTAGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPPPPLPGARGGLGLLEHFLP
PPPSSRSPSSSPGQLGQPPGEQSPGLAAGPPTTPETPPRQPERQSFVAGASGGASPGAFT
PRGGLSPPGHSPGPPRTFPSTPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLT
QDLKLISASQPALPQDGAQTLHRASPHSSGESMAAFPLFPRAGGSSGGSGGLGPSGRPYG
AIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAAPQREPGTRPEPVRSKLPSNL
Download sequence
Identical sequences H0XTX6
XP_003784534.1.62490 ENSOGAP00000019568 ENSOGAP00000019568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]