SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019583 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019583
Domain Number 1 Region: 65-172,230-416
Classification Level Classification E-value
Superfamily RNI-like 2.91e-65
Family 28-residue LRR 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019583   Gene: ENSOGAG00000034516   Transcript: ENSOGAT00000029406
Sequence length 429
Comment pep:known_by_projection scaffold:OtoGar3:GL873731.1:833439:851703:1 gene:ENSOGAG00000034516 transcript:ENSOGAT00000029406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGLPLAPAGINLLHSSDSLALASKNARITGVSHRTQPKCNYCIVTSKTSLWPVFPSCRP
ERNVLLDAYSQHLAAALCTNPDLVELGLYRNALGSQGVKLLCQGLRHPGCRLQNLRLKRC
QVSSSACRDLAAALTANKNLIRMDLSGNSLGLPGMKLLCEGLQHPQCRLQMVQQSFTLLP
SVECHGIIAYSSLKLLGSNNSLASASLAPTAMRLFCSFFHWIVYLKTHYLLKICHLTAAA
CEDLASTLSVNQNLMELDLSLNELGDPGVQLLCEGLRLPTCKLQTLRLGICRLGSGACRA
LSDVLQANPHLRELDLSFNDLGDWGLWLLSQGIGHSTCKLQKLWLDSCGLTAKACRDLYS
TLGINQTLTELYLTNNALGDSGVRLLCKRLSHPSCKLRVLWLFGMDLNKVTHSRLAALRL
TKPYLDIGC
Download sequence
Identical sequences H0XTZ1
ENSOGAP00000019583 ENSOGAP00000019583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]