SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019618 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019618
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019618   Gene: ENSOGAG00000011977   Transcript: ENSOGAT00000011981
Sequence length 272
Comment pep:known_by_projection scaffold:OtoGar3:GL873561.1:10445004:10445822:1 gene:ENSOGAG00000011977 transcript:ENSOGAT00000011981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQSDMVQKMPGESLSRAG
AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHP
VHPILGGALSSSNASSPLSAASLPGLGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
CTICQMPPPPHLSALSTANMARLSAESKDLLK
Download sequence
Identical sequences H0XU26
ENSOGAP00000019618 ENSOGAP00000019618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]