SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019656 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019656
Domain Number 1 Region: 5-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.33e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0000601
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000019656
Domain Number - Region: 62-93
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0191
Family Leucine zipper domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019656   Gene: ENSOGAG00000034529   Transcript: ENSOGAT00000034310
Sequence length 146
Comment pep:novel scaffold:OtoGar3:GL873795.1:972387:973201:1 gene:ENSOGAG00000034529 transcript:ENSOGAT00000034310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHNDDIQMESEADKPAHHNALERKRRDHLQDSFHRLRGSVPSLRGEKASRAQILEKAAE
YIQHLRRLDTHPHRQDIDNLRLQNALPQQQVCALGRRGQTNYPSSVGSLYTKATGSTVSA
LDGSDPSSQWEPEEPQTXKKKKLEYS
Download sequence
Identical sequences H0XU64
ENSOGAP00000019656 ENSOGAP00000019656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]