SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019726 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019726
Domain Number 1 Region: 62-191
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-47
Family Regulator of G-protein signaling, RGS 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019726   Gene: ENSOGAG00000002616   Transcript: ENSOGAT00000032847
Sequence length 197
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:11137881:11163544:1 gene:ENSOGAG00000002616 transcript:ENSOGAT00000032847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKNMLRFRTFTATELQGSR
RLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVS
KAHRIFEEFVDVQAPREVNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFL
RSKMYLDLLSQSQRRLS
Download sequence
Identical sequences H0XUD4
ENSOGAP00000019726 ENSOGAP00000019726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]