SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019800 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019800
Domain Number 1 Region: 155-281
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000129
Family 28-residue LRR 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019800   Gene: ENSOGAG00000026217   Transcript: ENSOGAT00000035139
Sequence length 342
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:3092273:3134259:-1 gene:ENSOGAG00000026217 transcript:ENSOGAT00000035139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTKGSLAERASPGAGPGPRRERPDFWASLLLRAGDKAGRAGASAGLPPYHRRVGMVQELL
RMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHC
PKPEGDALGAMEKLCRQLTYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDLSG
IPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGNRL
TRALLRDLTDTLKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILELG
EGPGSGEEAREGTVDQEDPGGCPVALAKDHHEVKETIAALET
Download sequence
Identical sequences H0XUK8
ENSOGAP00000019800 ENSOGAP00000019800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]