SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019857 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019857
Domain Number 1 Region: 120-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000916
Family HLH, helix-loop-helix DNA-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019857   Gene: ENSOGAG00000027746   Transcript: ENSOGAT00000024158
Sequence length 208
Comment pep:novel scaffold:OtoGar3:GL873547.1:17942149:17942858:-1 gene:ENSOGAG00000027746 transcript:ENSOGAT00000024158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGQVMYRVIQESEGQLGGQTVGTGVISGYPATQSMTQAVIQGAFTSDDAVETEGTAAETH
YYFPSTAVGNGAGSTTSGSTAAVVTTQGSGTGQFFGMMSPQEILQGGSQWKSEAPTTTYD
EKHRAQHNEVSCHHHDEINNWMVQLSKIILDCSMESTKSGQSKGGILSKACNYIQKLQQK
LQGLDQLQLDKDVLQQQVEDLKNKNVLL
Download sequence
Identical sequences H0XUR5
ENSOGAP00000019857 ENSOGAP00000019857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]