SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019862 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019862
Domain Number 1 Region: 196-360
Classification Level Classification E-value
Superfamily RNI-like 2.49e-42
Family 28-residue LRR 0.00000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019862   Gene: ENSOGAG00000032855   Transcript: ENSOGAT00000025256
Sequence length 544
Comment pep:known_by_projection scaffold:OtoGar3:GL873556.1:5198598:5206735:-1 gene:ENSOGAG00000032855 transcript:ENSOGAT00000025256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTP
TGTFSREALMAYWEKESQKLLEKERLGECGKVADEEEKEESEEELIFTETNSEVSEEVYT
EEDEAQDESQEEEDSDQEEGAVETAGGINGSVNYEGVNSDNCKPKTFKSQIENINLTNGN
SGRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLSRFAEALKDN
TVVKTFSLANTRADDSAAMAIAEMLRVNQHITSVNVESNFITGKGILAIMRALQHNTVLT
ELRFHNQRHIMGSQVEMEIVKLLRDNTTLLRLGYHFELPGPRMSMTSILTRNMDKQRQKR
MQEQKQQEGYDGGSALRTKVWQRGTPGSSPYASPRHSPWSSPKLPRKVQTVRSHPPSPVP
TPPPPPPPPLPPQSLQVPPPPPAPPLPEKKLVTRNIAEVIKQQETAQRALRNGQRKKKGK
KVKKQPNNILKEIKNSLRSVQEKKTEDSSRPSTPQRSAHDNLMEAIRGSSIRQLRRVEVP
EALR
Download sequence
Identical sequences H0XUS0
XP_003789825.1.62490 ENSOGAP00000019862 ENSOGAP00000019862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]