SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019916 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019916
Domain Number 1 Region: 104-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019916   Gene: ENSOGAG00000013827   Transcript: ENSOGAT00000013828
Sequence length 206
Comment pep:known_by_projection scaffold:OtoGar3:GL873682.1:117898:119414:-1 gene:ENSOGAG00000013827 transcript:ENSOGAT00000013828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSVSDPEEMELRGLHREYAVPASKRPPLRGTERSYVSPSDNSSAEEEDPDGEDDRCA
VGAAGGARGCKRKRPRAAGGVGAGGGAGSGGKKPLPPKGSAAESKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
PFVVSGRPDSDTKEVSAASRLCGTTA
Download sequence
Identical sequences H0XUX4
XP_003800082.2.62490 ENSOGAP00000019916 ENSOGAP00000019916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]