SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019947 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019947
Domain Number 1 Region: 557-815
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-85
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 40-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-71
Family Eukaryotic proteases 0.00044
Further Details:      
 
Domain Number 3 Region: 423-519
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000196
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 4 Region: 859-948
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000209
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 
Domain Number 5 Region: 358-414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000458
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019947   Gene: ENSOGAG00000025129   Transcript: ENSOGAT00000026234
Sequence length 1128
Comment pep:known_by_projection scaffold:OtoGar3:GL873576.1:8627561:8684638:-1 gene:ENSOGAG00000025129 transcript:ENSOGAT00000026234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALVGAGFLLLLVVGVSRSSGLECGISAPDLERKEPAVASGVFSRISSWRNSAVGSHPW
QVSLKLGEHHFCGGSLIQDDQVVTAAHCLVSLNAKQLKSLTVTSGKYNLFQKDKQEQNVP
VSKIIIHPEYNSLGFMSSDIALLYLTHKVKFGTAAQPIYLPNRDHNLEAGILCVASGWGK
ISETSARSNVLQEVELTIMDDRTCNAILKRMNLPALERTMLCAGFLDGGMDACQRDSGGP
LVCRRGGGIWTLAGITSWVAGCAGDSASVRNRHRKASLGIFSKVLELMDFITQNMITGGF
WSRQTLLKTSLSSITKGLSSVPGVRGSQEKSGKIIYPYSKEDNYSHNCISFFLSDVNLFS
KLYIISTDGEKGKGKVCEDTLPSPLLTETREASVTFVSDTENSGNGYNLTFAAVRNSEAG
PGCWSVAVLVEGTVRSADFPDLYPSHVQCHQLIRALDTHTVKLTFEAFTFEFNPNHIYDA
AVIYGDSKEDHELAKLSRILNTLIFSPSNMTVVCFKENDGKGRGVMWKIRVNSQARDSSN
KIEPTSPPQTIPVSAAKAIPYGICGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGD
HQCGGAIISPTWVLTAAHCVQSKDNPLSWTIIAGDHDRTLKESTEQVRRAKHIIVHEDFN
ILSYDSDIALVQLSSPLEYNAAVRPVCLPHGPEPLFSLEICAVTGWGSISKDGDLASRLQ
QIQVSVLEREACEHTYYSAHSGGITANMICAGSAASAGKDFCQGDSGGPLVCRHENGPFT
VYGIVSWGAGCVQPWKPGIFARVTVFLDWIYSKIKGPTSFRTSNKSKTLEQQLPPLVPST
DSASGPGCDSEVELDERRGFFSTPSYPLDYRGKLECSWVLRNSPNSVAKFTVEYLLLPGS
CVPEPHQLIPWVRRHTHKGSTCGSSENRDLGSQFFMSSAPLVRVTFHPLVQGAFGINYIV
FKKIKNKKDGKITRASSSSNQEPVVTFVDFLLTKPVRVIVMPRNISDFSHLCCHGQWGLV
APLNHIISLDVTNFQMKLRTLACPFLHIRKLVFGSEIFILISFLKKLGFIILKNVIRQKK
KERIINEVFFDIWNIITIHNVRSVGQKIIKKKFASSASYNRIQHKGAI
Download sequence
Identical sequences H0XV05
ENSOGAP00000019947 ENSOGAP00000019947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]