SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020003 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020003
Domain Number 1 Region: 420-829
Classification Level Classification E-value
Superfamily RNI-like 1.49e-78
Family 28-residue LRR 0.00000195
Further Details:      
 
Domain Number 2 Region: 20-111,142-163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000206
Family G proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020003   Gene: ENSOGAG00000033241   Transcript: ENSOGAT00000029167
Sequence length 829
Comment pep:novel scaffold:OtoGar3:GL873674.1:1843896:1859273:1 gene:ENSOGAG00000033241 transcript:ENSOGAT00000029167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQDHFINMEHVFDPDEAGFSLSRTVVLQGCAGIGKTALVHKFMFDWAAGIVSPGRFDYLI
YINCREISHIASLSAADLITNTFQDVRGPILDIVLIYPEKLLFILDGFPELQHPMGDQEE
ALSVQPQERKPVESLLCSFVRKKLLPESSLLITARPTAMKKLHSLLRQPIQAEILWFTSA
EKRAYFLSQFSGVKTAMKLFYGLRENEGLDVMSSLPIVSWMICSVLKSQGDGDRPLLRSL
QTMTDVYLFYFSKCLRTLTDVGVWKGQNCLWGLCCLAAEALQSRQVLFAASDLRRHGIGV
CDSSYTFLSHFLKKADDINAYTFLHFSFQEFLTAVFYVLKNDNKWMYLSQVGKAWHEIFQ
RYGKGFSSLTIRFLFGLLRKGKGKIMETTFGRKISPGLREELLKWTEREIKDKSSRLQIE
PVDLFHCLYEIREEEYSRRIMDDLHQVFSYSSISTVDNSVEVECSRHCCLAGLKKLCLKD
KYIVFPVTSAHYKCFFFFLMYLESACLFIITSEWLTELEFNETKLEVSALTLLCEGLKDP
NCRLQKLNFLPENSEAVCKCLASVVICNPNLTELDLSENPLGDIGVKYLCEGLKHSDCKV
EKLDLSTCCLTDASCVELSSCLQVSQTLKELFVFANAVGDTGVQHLCKGLQHPKCAIENL
VLSECSLSAACCQPLGQVLRASQSLTRLLLINNKIEDLGLKLLCEGLKQPDCQLKDLALW
TCHLTPACCKDLCNALYTNENLRVLDLSDNALGDEGMRVLCEGLKHPCCRLQTLWLAECH
LTDACCGALASVLNRNENLTLLDLTGNDLRDFGVQMLCDALIHPICKLQ
Download sequence
Identical sequences H0XV61
ENSOGAP00000020003 ENSOGAP00000020003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]