SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020024 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020024
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily Histone-fold 4.54e-26
Family Nucleosome core histones 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020024   Gene: ENSOGAG00000034528   Transcript: ENSOGAT00000024488
Sequence length 84
Comment pep:novel scaffold:OtoGar3:GL873537.1:6169087:6169341:-1 gene:ENSOGAG00000034528 transcript:ENSOGAT00000024488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKQTAHKSTSGKAPRKQLATKAAREIAQDFKTDLHFQSAAIGALQETSEAYLVGLFE
DTNLCAIHAKRVTIMPKDILAHRI
Download sequence
Identical sequences H0XV82
ENSOGAP00000020024 ENSOGAP00000020024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]