SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020047 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020047
Domain Number 1 Region: 183-334,363-529
Classification Level Classification E-value
Superfamily RNI-like 2.94e-26
Family Rna1p (RanGAP1), N-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 100-161
Classification Level Classification E-value
Superfamily F-box domain 0.00000000301
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020047   Gene: ENSOGAG00000024500   Transcript: ENSOGAT00000033917
Sequence length 536
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:525165:528127:1 gene:ENSOGAG00000024500 transcript:ENSOGAT00000033917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPATRHPRRRARTAPLAGTLARSAEDWWWDRLAPSDSGYHLLQADSMLLVLPGPSPAR
ARVRFRAQRRALRRTQRQRPVGPSAAAAKPKATPRPETASTPQQEPDAGWGDRVPLEILV
QIFGLLVAAEGPVPFLGRAARVCRRWQEAASHPALWHTVTLSPPLAGRPAKGGIKAEKKL
LSSLEWLMPNRFSQLQRLTLIHWKSQIHHVFKLVGESCPRLTFLKLSDCHGVTTDALVML
AKACHQLHSLDLQHSMVESTAVVSFLEEAGPRMRKLWLTYSSQTTAILGALLSSCCPQLQ
VLEVSTGINRNSTPLQLPVEALQRGCPQLQVLRLLNLVWLPKPSGRGVARGPGFPRLEEL
CLASFACNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLRDLPCQELEQLHLGLYGVS
DRLTLAKEGSPLLTQKWYRTLRELDLSGQGFSEKDLEQALAAFSGTPGGSHPALCSLNLR
GTRVTPSTISSVVSSCPGLLYLNLESCRCLPRGLKRVYRGLKEVQRCLEQLLTTPS
Download sequence
Identical sequences H0XVA5
ENSOGAP00000020047 ENSOGAP00000020047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]