SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020057 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020057
Domain Number 1 Region: 79-160
Classification Level Classification E-value
Superfamily F-box domain 1.7e-20
Family F-box domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020057   Gene: ENSOGAG00000030753   Transcript: ENSOGAT00000034194
Sequence length 309
Comment pep:known_by_projection scaffold:OtoGar3:GL873593.1:2418161:2447063:1 gene:ENSOGAG00000030753 transcript:ENSOGAT00000034194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAFAPPKSIDGPKMQTKMSTWTPLNHQLLNDQIFEERRALLGKWFDKWTDSQRRRILTG
LLERCSLSQQKFCCQKLQEKLPAESLDFTTKLPRVLSVYIFSFLDPRSLCRCAQVCWHWK
NLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHVTKPKTPPKDEFVIAD
VQPVTSSSPKEKQSPLSAFQSYSSLRRKSKAEKKELPPWRSSDKHPTDIIRFNYLDNCDP
LDSVWHGRKKRNEMTPDFSRQPHEKRNKLQDRSRLRKAQSLVSVTHKRFTTVMLMTITRS
PILFEKLVA
Download sequence
Identical sequences H0XVB5
ENSOGAP00000020057 ENSOGAP00000020057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]