SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020152 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020152
Domain Number 1 Region: 57-99
Classification Level Classification E-value
Superfamily F-box domain 0.0000288
Family F-box domain 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000020152
Domain Number - Region: 259-299
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0131
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020152   Gene: ENSOGAG00000032645   Transcript: ENSOGAT00000027241
Sequence length 368
Comment pep:known_by_projection scaffold:OtoGar3:GL873564.1:4638034:4681349:1 gene:ENSOGAG00000032645 transcript:ENSOGAT00000027241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAEARMAEEGGGGHGDGGSSSATGSAQRQPPQPPPQTPQPASQASPAPALSPDQLPQ
NNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQV
KAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRV
LRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPG
PSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQD
QKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQSEESPRKRKKATEAIDSLRK
SKRLRNRK
Download sequence
Identical sequences H0XVL0
ENSOGAP00000020152 XP_003791020.1.62490 ENSOGAP00000020152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]