SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020171 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020171
Domain Number 1 Region: 110-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.33e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020171   Gene: ENSOGAG00000029479   Transcript: ENSOGAT00000026053
Sequence length 271
Comment pep:known_by_projection scaffold:OtoGar3:GL873648.1:2747980:2748795:-1 gene:ENSOGAG00000029479 transcript:ENSOGAT00000026053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVKSETLELKEEEDMLVLLGSASPASAALTPLSSSADEEEEEELGASGGERPLRSAEAG
QGARGGSAAGAEGCRPARLLGLVHECKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNR
ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGAL
PGALFSEAVLLSPGGTSAALSSSGDSPSPASTWSCTNSPAPSSSASSNSTSPYSCTLSPG
SPAGSDMDYWQPPPSDKHRYAPHLPIARDCI
Download sequence
Identical sequences H0XVM9
ENSOGAP00000020171 XP_003798211.1.62490 ENSOGAP00000020171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]