SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020198 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020198
Domain Number 1 Region: 678-944
Classification Level Classification E-value
Superfamily RNI-like 1.16e-60
Family 28-residue LRR 0.0037
Further Details:      
 
Domain Number 2 Region: 17-105
Classification Level Classification E-value
Superfamily DEATH domain 1.08e-17
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000020198
Domain Number - Region: 157-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000875
Family G proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020198   Gene: ENSOGAG00000031455   Transcript: ENSOGAT00000032896
Sequence length 953
Comment pep:known_by_projection scaffold:OtoGar3:GL873547.1:12407796:12433888:-1 gene:ENSOGAG00000031455 transcript:ENSOGAT00000032896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQGHSEMETIPSDSPSYIKLLKTHRELLVTHIRNTQCLVDNLLKNDYFSAEDSEIVCA
CPTQPNKVRKILDLVQSKGEEVSEFFLYVLQQLTDAYVDLRPWLSQISFSPSQLIQSKIV
LNTDPVSRYTQQLRHHLGRDSKFTLCYGQKEEVLLEEMYMDTVMELVDFNNERLGSLDSL
ACLLDHATGVLDAQGETVFVCGDAGVGKSMVLQRLQNLWATSQLDTGVKFFFHFRCRMFS
CFKESDTLCLQDLLFKHYCYPEQDPDEVFSFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKVLTARTGVEVPRQLLRKKVLLRGFSPSHLRSY
ARRMFPERAMQDLLMTQLEANPNLCSLCAVPLFCWIIFQCFRHFHTAFEGSAQLPDCTVT
LTDIFLLVTEVHLNRTQPSSLLQRNTRSQVETFRAGRDTLRALGQVAHWGMEKGLFVFSQ
EEAQTSQLREEDLQLGFLRALPEPGPGGHQQSFEFFHLTLQAFFTAFFLVVDDKVGTRQL
LHFFQEWAPPGEPVATSCYPPLFPFQCLGGGGLAGGDPFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPVAALRRKRKALWAHLFSRLRSYLKSLPRVQTEVFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAAKGICANYLKLTYCNACSADCSALSFVLHHIRSQLALDLDNNNLNDYGV
QQLQPCFSRLTVIRLSVNQITDSGVKVLYEELTKYRIVTYLGLYNNQITDVGARYVSKIL
DECKGLMYLKLGKNKITSEGGKCLALAVKNSKSIFDIGMWGNQIGDEGAKAFAEALRNHP
SLTNLSLAFNGISTEGGKSLARALQQNTCLRIFWLTKNELNDEVAESMAEMLKVNQTLKH
LWLIQNQITARGLARLADALQNNTGIMEICLHGNPIKPEEAKVFEDENRLICF
Download sequence
Identical sequences H0XVQ5
ENSOGAP00000020198 ENSOGAP00000020198 XP_003788597.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]