SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020217 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020217
Domain Number 1 Region: 91-158
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020217   Gene: ENSOGAG00000033152   Transcript: ENSOGAT00000029787
Sequence length 244
Comment pep:known_by_projection scaffold:OtoGar3:GL873522.1:40337035:40337769:1 gene:ENSOGAG00000033152 transcript:ENSOGAT00000029787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPLETTCLSDLDCASSSSSDLSGFLTDEEDCAKLPPPASASGPPAPARRNTPGISGAS
DVPGAQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVL
PSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLSGGSARERLLPPQCAPCLPGPPSP
ASDAESWGSGAAASPCAAAASPISDPSSPATSEDFAYGPGDPLFSFPGLPKDLLHTTPCF
IPYH
Download sequence
Identical sequences H0XVS4
ENSOGAP00000020217 ENSOGAP00000020217 XP_003782224.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]