SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020268 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020268
Domain Number 1 Region: 329-454
Classification Level Classification E-value
Superfamily TIMP-like 1.24e-36
Family Netrin-like domain (NTR/C345C module) 0.000000833
Further Details:      
 
Domain Number 2 Region: 159-272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-36
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 3 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020268   Gene: ENSOGAG00000031809   Transcript: ENSOGAT00000025553
Sequence length 460
Comment pep:known_by_projection scaffold:OtoGar3:GL873661.1:353034:358294:-1 gene:ENSOGAG00000031809 transcript:ENSOGAT00000025553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATASLLGPLLTAWALLPFAQGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPN
KDCIWTVTVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL
VAPGNQVTLRMTSDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDY
PPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDAKRLGKFCGDAV
PGPISSEGNELLVQFVSDLSVTADGFSASYRILPLGAVQEGTARNPGEEAPLLGPGTKLE
TGPKVKTPTKPQLPPTEKSEATPVGPDTISVPCPKQCRRKGTLQSNFCASNLVVTATVKS
MVRGPGEGLTVTVSLIGVYKTGGLDLPSPPTETSLKFYVPCKQCPSMKKGASYLLMGQVE
KNRGPILPPESFVVLYRPNQDQILTNLSKRKCPSQPAPAA
Download sequence
Identical sequences H0XVX5
ENSOGAP00000020268 ENSOGAP00000020268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]