SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020277 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020277
Domain Number 1 Region: 57-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020277   Gene: ENSOGAG00000032370   Transcript: ENSOGAT00000034082
Sequence length 206
Comment pep:known_by_projection scaffold:OtoGar3:GL873780.1:143832:149007:-1 gene:ENSOGAG00000032370 transcript:ENSOGAT00000034082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQTPDALDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGTDCARYTTLSLLRRARMHIQKLQEQERWAQQLK
EKLRGEQQSLQLQLEQLRGPVGAGERERLRTDSLDSSGLSSERSDSDQEELEVDVESLVF
GGEAELLQGFSASQEHSYSHSAGAWL
Download sequence
Identical sequences H0XVY4
XP_003802856.1.62490 ENSOGAP00000020277 ENSOGAP00000020277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]