SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020322 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020322
Domain Number 1 Region: 64-143
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000664
Family Extracellular domain of cell surface receptors 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020322   Gene: ENSOGAG00000026688   Transcript: ENSOGAT00000029640
Sequence length 181
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:1615687:1617678:-1 gene:ENSOGAG00000026688 transcript:ENSOGAT00000029640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALRAVLLTLLLCRQPGRGQAQEEDHTRDDELDDESDDLEEEDEDEDEEEEANAIPGGR
LRVLGLQCYTCPALHREELCDKTHSCSGKETFCKTLVIHGNSESGLLTTYSMWCADSCKP
TSRTVEETQMTVTCCQSTLCNVPPWQHSQAQDSPPSGTDGCESVGTALLLSLLTSLWAMR
A
Download sequence
Identical sequences H0XW29
ENSOGAP00000020322 ENSOGAP00000020322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]