SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020414 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020414
Domain Number 1 Region: 16-96
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000135
Family Snake venom toxins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020414   Gene: ENSOGAG00000026504   Transcript: ENSOGAT00000025267
Sequence length 97
Comment pep:known_by_projection scaffold:OtoGar3:GL873810.1:107570:111435:1 gene:ENSOGAG00000026504 transcript:ENSOGAT00000025267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFHAGFLLAILLSLQLASAQAMWCHHCKGFGGCSHKSRCRGDSTHCVTVATRDLISFNN
LPLVTKRCQRGCPTIESLGLGPNVSIVCCQASLCNQD
Download sequence
Identical sequences H0XWC1
XP_012669154.1.62490 ENSOGAP00000020414 ENSOGAP00000020414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]