SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020419 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020419
Domain Number 1 Region: 156-353
Classification Level Classification E-value
Superfamily E set domains 3.97e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000262
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1e-22
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020419   Gene: ENSOGAG00000029803   Transcript: ENSOGAT00000029970
Sequence length 390
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:46138352:46139524:-1 gene:ENSOGAG00000029803 transcript:ENSOGAT00000029970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPVEGAGEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILVLIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALT
LASARGPLRKRSVAIARAKPKFSISPDSLS
Download sequence
Identical sequences H0XWC6
XP_003781193.1.62490 ENSOGAP00000020419 ENSOGAP00000020419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]