SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020461 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020461
Domain Number 1 Region: 54-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.18e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020461   Gene: ENSOGAG00000034847   Transcript: ENSOGAT00000033424
Sequence length 193
Comment pep:novel scaffold:OtoGar3:GL873653.1:4988228:4988809:1 gene:ENSOGAG00000034847 transcript:ENSOGAT00000033424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGCALLRPAPPALGVPGGCPARRRPPSPELLRCSRRRRPGAAEAGDGAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRTALAGGL
LEPAVQSSASRRPSGTTLAATSPSCTSSSPGHGGSSEPGSPRSAYSSEDSGCEGELSPAE
RELLEFSSWLGGC
Download sequence
Identical sequences B5FWC3
ENSOGAP00000020461 XP_003798460.1.62490 ENSOGAP00000020461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]