SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020463 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020463
Domain Number 1 Region: 159-187,214-414
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.78e-60
Family Voltage-gated potassium channels 0.00047
Further Details:      
 
Domain Number 2 Region: 33-130
Classification Level Classification E-value
Superfamily POZ domain 3.4e-27
Family Tetramerization domain of potassium channels 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020463   Gene: ENSOGAG00000009201   Transcript: ENSOGAT00000009203
Sequence length 499
Comment pep:known_by_projection scaffold:OtoGar3:GL873529.1:897809:901008:1 gene:ENSOGAG00000009201 transcript:ENSOGAT00000009203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV
Download sequence
Identical sequences A0A0D9SAD5 A0A1S3GEU1 G7MIG1 G7NW44 H0XWH0 U3C320
ENSOGAP00000020463 ENSOGAP00000020463 NP_001252905.1.72884 XP_003784086.1.62490 XP_003933487.1.74449 XP_005542460.1.63531 XP_005542461.1.63531 XP_005542462.1.63531 XP_007975811.1.81039 XP_007975812.1.81039 XP_007975813.1.81039 XP_007975814.1.81039 XP_007975815.1.81039 XP_007975816.1.81039 XP_010342315.1.74449 XP_010342316.1.74449 XP_010384571.1.97406 XP_011735454.1.29376 XP_011735455.1.29376 XP_011735456.1.29376 XP_011735457.1.29376 XP_011803445.1.43180 XP_011803446.1.43180 XP_011825331.1.47321 XP_011825333.1.47321 XP_011933730.1.92194 XP_011933731.1.92194 XP_011933733.1.92194 XP_011933734.1.92194 XP_012323534.1.9421 XP_012323535.1.9421 XP_012323536.1.9421 XP_012323537.1.9421 XP_012517245.1.63892 XP_012517246.1.63892 XP_012607148.1.48125 XP_012607149.1.48125 XP_012607150.1.48125 XP_012607151.1.48125 XP_012607152.1.48125 XP_012887336.1.60039 XP_015002418.1.72884 XP_015002428.1.72884 XP_015002435.1.72884 XP_017354813.1.71028 XP_017354814.1.71028 XP_017354815.1.71028 XP_017725119.1.44346 XP_017725120.1.44346 XP_017725121.1.44346 XP_017725122.1.44346 XP_017830501.1.60252 XP_021527601.1.9421 ENSDORP00000004070 ENSDORP00000004070 ENSMICP00000004804 ENSMICP00000004804 ENSPANP00000010223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]