SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020617 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020617
Domain Number 1 Region: 149-314
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.56e-41
Family Dual specificity phosphatase-like 0.0000182
Further Details:      
 
Domain Number 2 Region: 324-430
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.81e-24
Family PLC-like (P variant) 0.005
Further Details:      
 
Domain Number 3 Region: 10-142
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000345
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020617   Gene: ENSOGAG00000031231   Transcript: ENSOGAT00000027619
Sequence length 438
Comment pep:novel scaffold:OtoGar3:GL873740.1:927479:1028109:1 gene:ENSOGAG00000031231 transcript:ENSOGAT00000027619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSMITLFEYRIFGVLLIFIDVSLVITDLIFTSKIYIPLEYRSVSLAIALFFFMDLLLRVY
VEGRRHYFSDLLNVLDAFIIVAILLIDIIYIFYDVTFLRNIPRWAVFFRTLRLIILIRVF
HLAPQKRHLEKLTRRMVSENKRRYTRGGFDLDLTYVTERIIAMSFPSSGRQSFYRNPMTE
VVRFLDTKHPNHYRVYNLCSEKGYDPKHFHYRVCRLMIDDHNVPTLCEMLVFSKEVDEWM
TQDEENVIVVHCKGGKGRTGTMVCVSLIAREIFSTAEDSLYYFGERRTDKTSSSKFQGVE
TPSQNRYVGYFEQVKNTYQWNLPPRKMLLIKKVIIYSIHGVGKGNGYDLKIQIFMQRKAV
FSCSYSENCKVLYDMESDRVVIHVFNCPPLYDDIKVQFFSSSDLPKYYDDCPFFFWFHTS
FIKKNRTYFTQSFHLVFR
Download sequence
Identical sequences H0XWX4
ENSOGAP00000020617 ENSOGAP00000020617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]