SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020696 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020696
Domain Number 1 Region: 101-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000537
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020696   Gene: ENSOGAG00000033584   Transcript: ENSOGAT00000031005
Sequence length 268
Comment pep:novel scaffold:OtoGar3:GL873630.1:2817787:2818593:-1 gene:ENSOGAG00000033584 transcript:ENSOGAT00000031005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYAISQARVNAAPGTMLRPQRPGDLQLGTSLYELVGYRQAPSSSSSSSSSTSSSSTTAP
LLPKSAREKLEAPVEPPSTGPGSGAPAGGSSRADAKEEQQQQLRRKINSRERKRMQDLNL
AMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAA
PRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPG
LCTCAVCKFPHLVPAGLGLAAVQAQFSK
Download sequence
Identical sequences B5SNH7
ENSOGAP00000020696 ENSOGAP00000020696 XP_003797112.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]