SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020709 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020709
Domain Number 1 Region: 133-217
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020709   Gene: ENSOGAG00000000570   Transcript: ENSOGAT00000033000
Sequence length 297
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:11203714:11279880:-1 gene:ENSOGAG00000000570 transcript:ENSOGAT00000033000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRGRPRKEARCEGTGLASAAPPAVPPAALAAAPQPPAQPEEHAGAKPRCPFSDIFNTS
ENSMEKHINTFLQNVQILLEAASYLEQIEKENKKCEHGYASSFPSMPSPRLQHSKPPRRL
SRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNK
AKAHIKKLEEAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSD
SEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLQSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences H0XX66
ENSOGAP00000020709 XP_003787226.1.62490 ENSOGAP00000020709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]