SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020736 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020736
Domain Number 1 Region: 134-299
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.63e-23
Family Nuclease 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020736   Gene: ENSOGAG00000030522   Transcript: ENSOGAT00000026797
Sequence length 504
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:8301876:8336508:-1 gene:ENSOGAG00000030522 transcript:ENSOGAT00000026797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESQLSCLDEAHVNERVTEVQAAFYYCERRRAALEALLGGGEQAYRERVKKEQLRDFLS
SQERQALLAAWSPYEDAAPAAAARGKNKAKAKAPTQAPAEPGESLAYWPDRSDTEVPPLD
LGWTDTGFYRGVSRVTLFTHPPKEEKAPHLKQVVREMIQQAQKVIAVVMDLFTDGDIFQD
IVDASYKRRVPVYIILDEAGVKYFLEMCRGLQLTDFRIRNIRVRSVTGIGFYMPMGKVKG
TLSSRFLMVDGDKVVTGSYRFTWSSSSIDRNLLLLLTGQHVEPFDVEFRELYAISEEVDL
YRHLGLAGRLALNYSSTVARKLINPKYALVAGSRHPPGEMMRWAARQQREASSNPEGQEE
GGGGGESARRLESFLNDLVTIEQVLPPVDPLPSRELSQKDGRVVSRMHIDLKPKSQEATT
RNGMGEAANGEAAPAKESKRFGSRLFSQRAKRPAAPNGMTTSLSTENFAEVQFLMGKRPN
ESSSTDIPGKTGQIATKSSNCVIS
Download sequence
Identical sequences H0XX93
XP_003783226.1.62490 ENSOGAP00000020736 ENSOGAP00000020736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]