SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020815 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020815
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000693
Family Hairy Orange domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020815   Gene: ENSOGAG00000032001   Transcript: ENSOGAT00000028106
Sequence length 239
Comment pep:known_by_projection scaffold:OtoGar3:GL873576.1:5742111:5744082:-1 gene:ENSOGAG00000032001 transcript:ENSOGAT00000028106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDSKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQADLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGASAPSAAPTGSAAAPCLERAGQKLEPLAHCVPVIQRTQPSTELAAENDTD
Download sequence
Identical sequences H0XXH2
ENSOGAP00000020815 ENSOGAP00000020815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]