SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020826 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020826
Domain Number 1 Region: 122-284
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.45e-22
Family Nuclease 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020826   Gene: ENSOGAG00000025465   Transcript: ENSOGAT00000027713
Sequence length 1176
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:1161028:1165537:1 gene:ENSOGAG00000025465 transcript:ENSOGAT00000027713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSQSSSQGDNPLAPGYLPPHYKEYYRLAVDALAEGGSEAYSRFLASEGAPDFLCPEE
LEHVSRHLRPPQYVAREPPEGSPPDVDMDGSSGTYWPVNSDQAVPELDLGWPLTFGFQGT
EVTTLVQPPPPDSPSIKEEARRMIRSAQQVVAVVMDMFTDVDLLSEVLEAAARRVPVYIL
LDEMNAQHFLDMADKCRVNLHHVDFLRVRTVAGPTYYCRTGKSFKGHVKEKFLLVDCAVV
MSGSYSFMWSFEKIHRSLAHVFQGELVSSFDEEFRILFAQSEPLVPSAGTLARMDAYALA
PYTGAGPLVGVPGAGAQTPFSFPKRAHLMFPPPREEGLGFPTFLDPDRHFLSGFRREEPR
MPGGALEPHSGLRPLSRRLDAEAGPAGEFAGPRGFFQARHLEMDAFKRHSYAAADGAGAM
ENFTAARQVSRQTFLSHGDDFRFQTSHFHRDQLYQQHYQWDPQVAPARPQGLFEKLRAGR
PGFADQDDFALGAGPRFPELGLDGHQRLDYVPSSASREVRHGSDPAFGPAPRGLEPGGAL
RPNLGQRFPCQAVARSGPDNTAEAEPERRGGPEGRAGLRHWRLASYLSGCHGEDAGDEGL
PVPVPMEAEAYEDDVLVSGGRAAAGDLLPSTFRVPAAFPTKGPVLGSGSGGGEVPEEAAL
AKQDSFRSRLNPFIQRSSRLRSSLIFSASQAEGAGVAAGSTTEKVQLLHKEQTVSETLGP
GGEAVRSSASAKVAELLEKYKGPARDSGGEGGAVAVASHSKAVVSQTWREEVAAPGGAGS
ERRSLESCLLDLRDSFTQRLHQEAERQPGVASFTAAQLLDTLGRGGTDRLPSRLLSAQSA
STSVQGPDKLLTLEGSRAQQVPHSEPKESPTVAYPERKGSPTPGFSIRRSSPTTGFIEQK
GSPTSPYPERRGSPVPPVPERRGSPVPPVPERRGSLTLTSGETAKTGPGEEAAGGPMDVL
RKGSLRLRQLLSPKSERRPEEEGGFSVPQENGQPESPRQQSLSRGDSMEATTGDERGPRS
RLASATANALYSSNLRDDTKAILEQISAHGQKHRGVPAPGPSPAHSSPELGHPLAAGGLA
PDMSDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCK
KEEAGGLGEGPAEEGTRDSKAGKFVPKILGTFKGKK
Download sequence
Identical sequences H0XXI3
ENSOGAP00000020826 ENSOGAP00000020826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]