SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020846 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020846
Domain Number 1 Region: 29-69
Classification Level Classification E-value
Superfamily F-box domain 0.000000131
Family F-box domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000020846
Domain Number - Region: 304-386
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00455
Family Insect pheromone/odorant-binding proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020846   Gene: ENSOGAG00000030630   Transcript: ENSOGAT00000025862
Sequence length 404
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:29520031:29547896:-1 gene:ENSOGAG00000030630 transcript:ENSOGAT00000025862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVGGGGDRCGSSSADPRSTFVLSNLAEVVERVLTFLPAKALLRVAGVCRLWRECVRRV
LRTHRSVTWISAGLAEAGHLEGHCLVRVAAEELENVRILPHTVLYMADSETFINLEECRG
HKRARKRTSMETAFALEKLFPKQCQILGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLF
PQIEGIKIQPFHFTKDPKKLTIERHQLTEVGLIDNPELRVVLIFGYNCCKMGASNYLHRV
VSSFSDMNIILAGGQVDNLSSLTSQKNPVDLDATGVVGLSFSGLRIQSATVLLNEDVTDE
KSAEAAMQRLKAANIPEQNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFG
NGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
Download sequence
Identical sequences H0XXK3
XP_003784598.1.62490 ENSOGAP00000020846 ENSOGAP00000020846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]