SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020897 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020897
Domain Number 1 Region: 123-218
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-40
Family Forkhead DNA-binding domain 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020897   Gene: ENSOGAG00000032689   Transcript: ENSOGAT00000028824
Sequence length 380
Comment pep:known_by_projection scaffold:OtoGar3:GL873522.1:6956510:6959400:-1 gene:ENSOGAG00000032689 transcript:ENSOGAT00000028824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPPSFEGGGEYGATP
NPYLWLNGPTMTPAPYLPSANASPFLPQAYGVQRPLLPSVPGLGGSELGWLPLPSQEELM
KLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLND
CFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTGSLASEKPENGLL
VGSPKSTEPQDVLDSASPGTTSPSEKRSPPPPTGTPCLSSFLSTVTAFTGGASSAGRPVA
TPGLNPEPTDKMGQNSLSFNSFTPLTNLGSHGGGGEWANPMPANALGYGGSVLNQFSPHF
YNSISTNTNSVLYPREGTEV
Download sequence
Identical sequences H0XXQ4
ENSOGAP00000020897 ENSOGAP00000020897 XP_003782004.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]